TBC1D7 Rabbit Polyclonal Antibody TA345015 from OriGene Technologies | Biocompare.com

Supplier Images

TBC1D7 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
TBC1D7 Rabbit Polyclonal Antibody

OriGene Technologies' TBC1D7 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The TBC1D7 Rabbit Polyclonal Antibody was generated using TBC1D7-LOC100130357 as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-TBC1D7 Antibody - C-terminal region

Product Specs
ItemTBC1D7 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA345015
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetTBC1D7
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Tbc1d7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tbc1d7. Synthetic peptide located within the following region: ISRCFVKQLNNKYRDALPQLPKAFEQYLNLEDSRLLSHLKTCSAVSKLPY
NCBI Full Gene NameTBC1 domain family member 7
NCBI Gene AliasesTBC7, MGCPH, PIG51
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!